PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_002107-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family HD-ZIP
Protein Properties Length: 736aa    MW: 80688.3 Da    PI: 5.9531
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_002107-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.43.2e-2062117156
                      TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      +++ +++t++q++e+e++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k
  AHYPO_002107-RA  62 KKRYHRHTQHQIQEMENFFKECPHPDDKQRKELSRRLGLEPLQVKFWFQNKRTQMK 117
                      688999***********************************************998 PP

2START220.26.7e-692544741206
                      HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEE CS
            START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaet 81 
                      ela +a++el+++ +++ep+Wv s+    e++n++e+ ++f+++ +      ++ea+r+s vv+m++++lve+l+d++ qW+  +     +a+t
  AHYPO_002107-RA 254 ELAVAAMEELIQMSQSGEPLWVPSPdnsiEMLNEEEYFRTFPRGIGpmplgLKSEASRDSSVVIMNHMNLVEILMDVN-QWSCVFSgivsRAMT 346
                      57899**************************************999********************************.*************** PP

                      EEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE CS
            START  82 levissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwve 168
                      l+v+s+g      galq+m+ae+q++splvp R+ +fvRy++q+g+ +wv+vdvS+d  ++ p    + R++++pSg+li++++ng+skvtwve
  AHYPO_002107-RA 347 LDVLSTGvagnyhGALQVMTAEFQVPSPLVPtRENYFVRYCKQHGDSTWVVVDVSLDGLRPSP----IPRCRRRPSGCLIQELPNGYSKVTWVE 436
                      *************************************************************99....6************************** PP

                      -EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
            START 169 hvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                      hv++++r +h +++slv+sgla+gak+wv+tl+rqce+
  AHYPO_002107-RA 437 HVEVDDRAVHTIYKSLVNSGLAFGAKRWVSTLDRQCER 474
                      ************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.84E-1949119IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.0E-2150117IPR009057Homeodomain-like
PROSITE profilePS5007116.84459119IPR001356Homeobox domain
SMARTSM003896.0E-1960123IPR001356Homeobox domain
CDDcd000863.95E-1962120No hitNo description
PfamPF000468.3E-1862117IPR001356Homeobox domain
PROSITE patternPS00027094117IPR017970Homeobox, conserved site
SuperFamilySSF559612.58E-37245476No hitNo description
PROSITE profilePS5084844.868245477IPR002913START domain
CDDcd088752.07E-126249473No hitNo description
SMARTSM002344.5E-69254474IPR002913START domain
PfamPF018521.2E-57255474IPR002913START domain
Gene3DG3DSA:3.30.530.201.1E-5359473IPR023393START-like domain
SuperFamilySSF559618.25E-26495727No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0009913Biological Processepidermal cell differentiation
GO:0048497Biological Processmaintenance of floral organ identity
GO:0048825Biological Processcotyledon development
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 736 aa     Download sequence    Send to blast
MFQPNMFEAH HQLLDMTSGH KTPDHTELGK IRDDEFESSR SATENLEGLS GDDQDPNQRP  60
KKKRYHRHTQ HQIQEMENFF KECPHPDDKQ RKELSRRLGL EPLQVKFWFQ NKRTQMKAQH  120
ERSENQQLRS ENDKLRADNI RFKEALSNAT CPNCGSPAAI GEMSFDEQQL RIENARLREE  180
IDRISGIAAK YVGKPLVNYS NIQNQGLHSR SSLDLGVGSF GPQSGMVGDI YGSSGDLLRT  240
VAPPTEADRP MIIELAVAAM EELIQMSQSG EPLWVPSPDN SIEMLNEEEY FRTFPRGIGP  300
MPLGLKSEAS RDSSVVIMNH MNLVEILMDV NQWSCVFSGI VSRAMTLDVL STGVAGNYHG  360
ALQVMTAEFQ VPSPLVPTRE NYFVRYCKQH GDSTWVVVDV SLDGLRPSPI PRCRRRPSGC  420
LIQELPNGYS KVTWVEHVEV DDRAVHTIYK SLVNSGLAFG AKRWVSTLDR QCERLASVMA  480
SNIPAGEGGV ITSAEGRKSM LKLAERMVMS FCAGVGASTA HTWTTLSGSG ADDVRVMTRK  540
SMDDPGRPPG IVLSAATSFW LPVSPKRVFD FLRDENSRSE WDILSNGGLV QEMAHIANGR  600
DPGNCVSLLR VNSANSSQSN MLILQESSTD STGSYVIYAP VDIVAMNVVL NGGDPDYVAL  660
LPSGFAILPD GPFGSHGSGP ILEVGSGGSL LTVAFQILVD SVPTAKLSLG SVATVNSLIK  720
CTVERIKAAV AGENA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010665524.10.0PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like
RefseqXP_010665525.10.0PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like
SwissprotQ93V990.0PDF2_ARATH; Homeobox-leucine zipper protein PROTODERMAL FACTOR 2
TrEMBLA0A0J8B6V00.0A0A0J8B6V0_BETVU; Uncharacterized protein
STRINGVIT_10s0116g00680.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0protodermal factor 2